TodayBuildContextBrowseMore
stackBETAv0.1
TodayBuild a stackCommon stacksEncyclopediaPulse
Methodology
← Back to your stack
Monograph
RESEARCH GREYP-015
Metabolic

Retatrutide

Triple agonist (GIP/GLP-1/glucagon). Phase 3 trials show greater weight loss than tirzepatide; not yet approved.

EmergingMetabolic
Typical dose1-12 mg
Frequencyweekly, subcutaneous
Half-life132h
Citations indexed38
DeliveryInjectable
Half-life~6d
EvidenceEmerging
Citations38
Similar compounds
Synergy checkCompareReconstitution calc
Research grey

This compound sits in research-grey territory. The caveats below carry more weight than for FDA-approved entries — read them.

Mechanism

Eli Lilly's triple-agonist of GIPR/GLP-1R/GCGR. Phase 2 (NEJM 2023) showed up to 24% weight reduction at 48 weeks — exceeding tirzepatide. Phase 3 TRIUMPH trials underway. Glucagon-receptor activation distinguishes mechanism — risks and benefits distinct from semaglutide/tirzepatide.

Specifics
Weight / fat lossAppetite controlInsulin sensitivity
Caveats

Not yet FDA-approved. Any product sold as 'retatrutide' before approval is research-grade at best, counterfeit at worst. Glucagon agonism creates a different metabolic profile than tirzepatide.

sequence · 39 aa
YXQGTFTSDYSKYLDERAAQDFVQWLLDGGPSSGAPPPS

Aib at position 2; fatty acid acylation. Triple agonist sequence engineered for GIP/GLP-1/glucagon receptor activity.

Evidence levelEmerging
Regulatory statusInvestigational — Eli Lilly Phase 3, expected FDA filing 2026
DNA / pharmacogenomicsDocumented — GLP1R / GIPR / GCGR variant interactions all relevant. PG protocols emerging.
Pairs & ConflictsCheck full stack →
Avoid stacking

Known risk or pharmacological conflict.

TirzepatideSemaglutideLiraglutideDulaglutideExenatide
Where the experts disagree

Stack doesn't rank peptides — we surface the diversity of opinion. Each card paraphrases a public-record stance from a named source. Where they conflict is where you should slow down and read both.

RCT / meta-analysisEli Lilly TRIUMPH program — Phase 2/3 trials, 2023-2026

Phase 2 TRIUMPH-1 (NEJM 2023) showed ~24% body-weight reduction at 48 weeks at maximum dose — larger than any other approved or pending obesity drug. Triple agonism at GLP-1 + GIP + glucagon receptors. Phase 3 ongoing with FDA approval expected late 2026 / early 2027.

Source →
Biohacker / coachEric Janicki, bodybuilding coach (YouTube tier-list, 2026)· 2026-04

S-tier — top of his peptide ranking. "GLP-3 — three receptors, suppresses appetite AND accelerates metabolism. I've been taking Reta for about a year. Reduces food noise without hunger suppression to the point of nausea." Has used personally for 12+ months.

ClinicianObesity-medicine practitioner consensus, 2025-2026

Pre-FDA-approval, Retatrutide use by patients is research-grey only. Several telehealth platforms paused compounded-Reta access after Eli Lilly's April 2025 lawsuits against compounders. Until FDA approval lands, all Retatrutide access carries quality + legal exposure that exceeds Tirzepatide-era compounding.

Claims & evidence

Per-claim grading. Each claim is graded independently — same peptide, different claims can carry different grades.

  • CLimited evidence

    Retatrutide — primary mechanism: triple agonist (gip/glp-1/glucagon). phase 3 trials show greater weight loss than tirzepatide; not yet approved.

    2 supporting referencesVerified 5d ago
References

External links to PubMed searches, ClinicalTrials.gov, and FDA materials. We do not host papers — we point at canonical sources.

  • PubMedEN
    REVIEWFunding undisclosedVerified 5d ago
    PubMed — Retatrutide
  • Clinical trialEN
    RCTFunding undisclosedVerified 5d ago
    ClinicalTrials.gov — TRIUMPH Phase 3
Reconstitution calculatorRetatrutide

Pre-filled with this compound's published dose range: 1-12 mg · weekly, subcutaneous

Concentration2.50 mg/mL
Draw volume2.600 mL
Insulin syringe260.0 u
Doses per vial0
U-100 syringe — fill to indicatorU-100 · 1 mL
0u25u50u75u100u
Watch

Draw volume exceeds 100 units (1 mL). Either reduce dose or split into multiple injections.

Calculator is a discussion tool. Verify reconstitution + dosing with a qualified provider. Stack is not a prescription source. Use sterile technique and inspect every vial.

First cycle costCheapest legal from $120

How much a first cycle actually costs across the channels people use. Pick the protocol length you're considering — Stack multiplies the monthly band by cycle weeks. Same caveats apply: ranges are facts, quality varies, this is not legal advice.

Research grey$120–$380

Numbers reflect publicly-advertised price ranges, not vendor quotes. Insurance, prescription costs, and shipping aren't included. Channels marked unavailable are filtered out.

See pharmacies for this compound →
Price across channelsRange $120–$380/mo

Approximate monthly cost across the channels users actually consider — brand FDA-approved retail, US 503A compounding, Mexican pharmacies, MX farmacias magistrales, and the research-grey market. Stack lists ranges, not vendor names. Quality varies wildly across channels — see each band's note.

FDA-approved brandNot legally available

Not yet FDA-approved (Phase 3 trials ongoing as of April 2026).

As of 2026-04
Research grey$120–$380/mo

Research-grey only — no legitimate pharmacy access until FDA approval. Premium over Tirzepatide grey market reflects newer-compound scarcity.

As of 2026-04
RESEARCH GREYP-015

Investigational — Eli Lilly Phase 3, expected FDA filing 2026

Retatrutide1-12 mg · weekly, subcutaneous
Discussion guide, not prescription

stack is an exploration engine. Output is a discussion guide for a conversation with a licensed provider — never a prescription, dose recommendation, or sourcing instruction. Peptides discussed include compounds with limited human evidence and varying legal status by jurisdiction. Verify everything with a qualified clinician before any decision.

Full terms →
stackv0.1
AudiencesWho Stack is forFor researchersFor pharmaciesFor cliniciansFor press
Trust & regulatoryCalibrationMethodologyFDA statusPharmacy registryPCAC commentMX · COFEPRIS
Built honest. Bilingual from day one.